| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331956.1 | 5prime_partial | 185 | 2-559(+) |
Amino Acid sequence : | |||
| EGTVNAYKKQFQSDLVAFLRSRSKELKPGGSMFLMLLGRTSPDPEDQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPGLEEFKEVVERDGAFIINKLQLFHGGSALIIDDP NDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSRLLSRAVAQAKELMDLFQLVHIVASLTLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,572.175 | ||
| Theoretical pI: | 5.076 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 45.312 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.216 | ||
| sheet | 0.292 | ||