| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331961.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
| GSAEFDATLTCKQFPSISLGCFPTVELYDGPSYYTQTTNSLEPQLPEGFIPSRIDANWLDPNSIYQNLDTSYVEVSNIDANHILEEDVDNSTAYSQSLVCETEFKNSLHLTADNPCSYAG STTQLTPVSVAETLDKSIKCIGLSKRQCTQLENCGFYTLRKLLHHFPRTYVDLQNADVEIDDGQYMIFVGKVISSRGVRTSSSFSYLEVVVASDVADIMSNSNGAADEVEKSKRTIYLHL KKFFRGARFTCMPFLKI | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,661.825 | ||
| Theoretical pI: | 4.874 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23880 | ||
| Instability index: | 37.939 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.249 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331961.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
| GSAEFDATLTCKQFPSISLGCFPTVELYDGPSYYTQTTNSLEPQLPEGFIPSRIDANWLDPNSIYQNLDTSYVEVSNIDANHILEEDVDNSTAYSQSLVCETEFKNSLHLTADNPCSYAG STTQLTPVSVAETLDKSIKCIGLSKRQCTQLENCGFYTLRKLLHHFPRTYVDLQNADVEIDDGQYMIFVGKVISSRGVRTSSSFSYLEVVVASDVADIMSNSNGAADEVEKSKRTIYLHL KKFFRGARFTCMPFLKI | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,661.825 | ||
| Theoretical pI: | 4.874 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23880 | ||
| Instability index: | 37.939 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.249 | ||
| sheet | 0.214 | ||