Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331965.1	5prime_partial	134	3-407(+)
Amino Acid sequence :
KIEMASSVKYVRVGPNSASLEEARRRVFDFFKTACRSIPTIMDVYNLDDVVTPSQLRSTVASEIRKNAHVDNPKVIDMLLFKGTEELNNIVEHSKQRHHIIGQYVLNRQDLAQDVGAKDP RSEFLKKFLRSNYF*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		15,439.458
Theoretical pI:		9.300
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		58.072
aromaticity		0.082
GRAVY		-0.467
Secondary Structure Fraction
Helix		0.313
turn		0.209
sheet		0.216