| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331967.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
| PDTDPRSFMNQANIHCAYCNTAYKQGGGDDTVPLQIHNSWLFFPFHRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSPIYDEKREPTHLTSIVDLGRTGSTDPLQVV ANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHTSIHIFVGDSRQPRKENMGNFYSAGRDPLFYCHHANVDRMWTVWQKLPSTVIPKKTIDDPDFLNATFLLYDENGKL VRVSVKDTIDHRKMGY | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,276.759 | ||
| Theoretical pI: | 6.321 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
| Instability index: | 39.842 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.462 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.273 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331967.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
| PDTDPRSFMNQANIHCAYCNTAYKQGGGDDTVPLQIHNSWLFFPFHRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSPIYDEKREPTHLTSIVDLGRTGSTDPLQVV ANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHTSIHIFVGDSRQPRKENMGNFYSAGRDPLFYCHHANVDRMWTVWQKLPSTVIPKKTIDDPDFLNATFLLYDENGKL VRVSVKDTIDHRKMGY | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,276.759 | ||
| Theoretical pI: | 6.321 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
| Instability index: | 39.842 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.462 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.273 | ||
| sheet | 0.168 | ||