Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331969.1	5prime_partial	227	2-685(+)
Amino Acid sequence :
RSLLIFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKEGTVNAYKKQFQSDLVAFLRSRSKELKPGGSMFLMLLGRTSPDPEDQGAWILTFSTRYQDAWNDLVQEGLISSEKRDT FNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSRLLSRAVAQAKELMDLFQLVHIVASLTLA*
Physicochemical properties
Number of amino acids:		227
Molecular weight:		25,367.651
Theoretical pI:		5.701
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25440
Instability index:		43.102
aromaticity		0.097
GRAVY		-0.064
Secondary Structure Fraction
Helix		0.344
turn		0.220
sheet		0.291