Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331972.1 | 5prime_partial | 204 | 683-69(-) |
Amino Acid sequence : | |||
EDFDPVAIAKAYEKGGAACLSVLTDEKFFQGSFENLEIIRNSGVQCPLLCKEFIVDVWQIYYARVKGADAVLLIAAVLSDFEIKYMIKICKLLGLAALVEVHDEREMDRVLAIEGIELVG INNRDLGTFKVDISNTKKLLEGERGERIRKKDIIVVGESGLFTPDDIAYVQGAGVKAVLVGESIVKKKDPTAGIVELFGKDIAS* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 11,218.984 | ||
Theoretical pI: | 11.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 99.399 | ||
aromaticity | 0.038 | ||
GRAVY | 0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.371 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331972.1 | complete | 105 | 184-501(+) |
Amino Acid sequence : | |||
MSSGVNSPDSPTTMMSFLRILSPRSPSRSFFVLLISTLNVPRSRLLMPTSSMPSIAKTRSISLSSCTSTSAASPSNLHILIMYLISKSDKTAAINRTASAPLTRA* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,218.984 | ||
Theoretical pI: | 11.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 99.399 | ||
aromaticity | 0.038 | ||
GRAVY | 0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.371 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331972.1 | 5prime_partial | 204 | 683-69(-) |
Amino Acid sequence : | |||
EDFDPVAIAKAYEKGGAACLSVLTDEKFFQGSFENLEIIRNSGVQCPLLCKEFIVDVWQIYYARVKGADAVLLIAAVLSDFEIKYMIKICKLLGLAALVEVHDEREMDRVLAIEGIELVG INNRDLGTFKVDISNTKKLLEGERGERIRKKDIIVVGESGLFTPDDIAYVQGAGVKAVLVGESIVKKKDPTAGIVELFGKDIAS* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 11,218.984 | ||
Theoretical pI: | 11.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 99.399 | ||
aromaticity | 0.038 | ||
GRAVY | 0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.371 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331972.1 | complete | 105 | 184-501(+) |
Amino Acid sequence : | |||
MSSGVNSPDSPTTMMSFLRILSPRSPSRSFFVLLISTLNVPRSRLLMPTSSMPSIAKTRSISLSSCTSTSAASPSNLHILIMYLISKSDKTAAINRTASAPLTRA* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,218.984 | ||
Theoretical pI: | 11.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 99.399 | ||
aromaticity | 0.038 | ||
GRAVY | 0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.371 | ||
sheet | 0.248 |