Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331980.1 | 5prime_partial | 198 | 810-214(-) |
Amino Acid sequence : | |||
EKPLHKVLDGGKAADIFLWRDKKASASVLGGATAAWVLFDVMEYHLLTLICHALIFGVVGLFLWSNANAFIKKSPPHVPQVVIPEEPVNKFASELRIGINRGFAVLRDIASGKDLKKFLS VVAGLWVLSYVGSCCDSLTLLFTITILLFTVPILYEKYEDKVDFYGEKAMAEVKKQYAVFDAKVLSKIPRGPLKDKKH* | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 16,349.633 | ||
Theoretical pI: | 10.201 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 51.382 | ||
aromaticity | 0.081 | ||
GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
Helix | 0.236 | ||
turn | 0.270 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331980.1 | complete | 148 | 353-799(+) |
Amino Acid sequence : | |||
MGTVNRSIVIVKSSVKESQQLPTYDKTHNPATTERNFFKSFPEAMSLKTAKPRLIPILSSEANLFTGSSGITTCGTCGGDFFMKALAFDHKKRPTTPKMRAWQIKVSRWYSMTSNNTQAA VAPPRTEAEAFLSLHRNISAALPPSRTL* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,349.633 | ||
Theoretical pI: | 10.201 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 51.382 | ||
aromaticity | 0.081 | ||
GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
Helix | 0.236 | ||
turn | 0.270 | ||
sheet | 0.236 |