| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331980.1 | 5prime_partial | 198 | 810-214(-) |
Amino Acid sequence : | |||
| EKPLHKVLDGGKAADIFLWRDKKASASVLGGATAAWVLFDVMEYHLLTLICHALIFGVVGLFLWSNANAFIKKSPPHVPQVVIPEEPVNKFASELRIGINRGFAVLRDIASGKDLKKFLS VVAGLWVLSYVGSCCDSLTLLFTITILLFTVPILYEKYEDKVDFYGEKAMAEVKKQYAVFDAKVLSKIPRGPLKDKKH* | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 16,349.633 | ||
| Theoretical pI: | 10.201 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 51.382 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.270 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331980.1 | complete | 148 | 353-799(+) |
Amino Acid sequence : | |||
| MGTVNRSIVIVKSSVKESQQLPTYDKTHNPATTERNFFKSFPEAMSLKTAKPRLIPILSSEANLFTGSSGITTCGTCGGDFFMKALAFDHKKRPTTPKMRAWQIKVSRWYSMTSNNTQAA VAPPRTEAEAFLSLHRNISAALPPSRTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,349.633 | ||
| Theoretical pI: | 10.201 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 51.382 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.270 | ||
| sheet | 0.236 | ||