| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331991.1 | 3prime_partial | 138 | 2-415(+) |
Amino Acid sequence : | |||
| MSLPMKCEDAMPVPNPTMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDAYWTATGQVQKSAGDTSFTLAWMPGEQGQQALLVWFNEGDTRAYKI RFPNGTVDVFRGWVSSIG | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,178.750 | ||
| Theoretical pI: | 4.333 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
| Instability index: | 30.945 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.268 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331991.1 | 3prime_partial | 138 | 2-415(+) |
Amino Acid sequence : | |||
| MSLPMKCEDAMPVPNPTMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDAYWTATGQVQKSAGDTSFTLAWMPGEQGQQALLVWFNEGDTRAYKI RFPNGTVDVFRGWVSSIG | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,178.750 | ||
| Theoretical pI: | 4.333 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
| Instability index: | 30.945 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.268 | ||
| sheet | 0.232 | ||