| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331997.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| TEKAELEEFRRMLLSCAAVHRHKDGDRFGDTLSERNADLLDRMVCVTSGVSYLGIAIVNQLLVNGYSVRIIVDNEEDVEKLREMETSGEMRLNNSIIEVVMAKLTEVESLTEAFDGCRGV FHTAAFVDPAGLSGYSKAMAEIEVNTSKNVVKACGISPSVRHCVLTSSLLTCIWRDNSSEEAPRVIDHKCWSDEAVCVNKKLWYALGKLRAEKAAWEIAKASGLKLTTICPGLITGSDFY RRNLTSTIAYLKG | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,971.759 | ||
| Theoretical pI: | 5.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31440 | ||
| Instability index: | 37.249 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.086 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.206 | ||
| sheet | 0.296 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331997.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| TEKAELEEFRRMLLSCAAVHRHKDGDRFGDTLSERNADLLDRMVCVTSGVSYLGIAIVNQLLVNGYSVRIIVDNEEDVEKLREMETSGEMRLNNSIIEVVMAKLTEVESLTEAFDGCRGV FHTAAFVDPAGLSGYSKAMAEIEVNTSKNVVKACGISPSVRHCVLTSSLLTCIWRDNSSEEAPRVIDHKCWSDEAVCVNKKLWYALGKLRAEKAAWEIAKASGLKLTTICPGLITGSDFY RRNLTSTIAYLKG | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,971.759 | ||
| Theoretical pI: | 5.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31440 | ||
| Instability index: | 37.249 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.086 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.206 | ||
| sheet | 0.296 | ||