Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331999.1 | 5prime_partial | 216 | 3-653(+) |
Amino Acid sequence : | |||
KMAQLARNAARILHQTAPFNHRAAMASIHTTAPSLAAASSTPTPYSSSPPPSGSPPVGMSKAAEFVISKVDDVMNYVRRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQS DCMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLLQLQKKINRRRDFYHWWTK* | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 13,308.906 | ||
Theoretical pI: | 9.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 75.776 | ||
aromaticity | 0.050 | ||
GRAVY | -0.613 | ||
Secondary Structure Fraction | |||
Helix | 0.242 | ||
turn | 0.300 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331999.1 | 5prime_partial | 120 | 2-364(+) |
Amino Acid sequence : | |||
ENGSAGSKCCSHPPPNGAVQPSRRHGVDPHHRSIPRRRFLHADAVLLVSSPIGLTPRRNVQGGRVCDLEGGRCHELCPSRLHLADDLRIGLLRRGDDAYRRRALRFGSVWNYFPAESEAV * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,308.906 | ||
Theoretical pI: | 9.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 75.776 | ||
aromaticity | 0.050 | ||
GRAVY | -0.613 | ||
Secondary Structure Fraction | |||
Helix | 0.242 | ||
turn | 0.300 | ||
sheet | 0.217 |