| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332013.1 | internal | 219 | 2-658(+) |
Amino Acid sequence : | |||
| AAAQLLGVTQPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSVRVSE EYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIPSNPMRYTG | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 12,178.004 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 82.030 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.243 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332013.1 | 5prime_partial | 103 | 1-312(+) |
Amino Acid sequence : | |||
| SRRPTSRGDTAGGRILRLPRRPQFQILLRNPTREALHPILPPPRPDPAREGLRLHDPRVRVGYRLDVPEILHQLRQLGLRGVRRRYAGARPLRRDPRLHRRYE* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,178.004 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 82.030 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.243 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332013.1 | internal | 219 | 2-658(+) |
Amino Acid sequence : | |||
| AAAQLLGVTQPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSVRVSE EYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIPSNPMRYTG | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 12,178.004 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 82.030 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.243 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332013.1 | 5prime_partial | 103 | 1-312(+) |
Amino Acid sequence : | |||
| SRRPTSRGDTAGGRILRLPRRPQFQILLRNPTREALHPILPPPRPDPAREGLRLHDPRVRVGYRLDVPEILHQLRQLGLRGVRRRYAGARPLRRDPRLHRRYE* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,178.004 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 82.030 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.243 | ||
| sheet | 0.233 | ||