| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332018.1 | 3prime_partial | 221 | 75-737(+) |
Amino Acid sequence : | |||
| MDFLFGNLNGGSENFDHDIGRCPFLRNINEPTNLSFATSMAFPIPVRDGKGPIFEDGPNFDMAFRLFHGQNGVVPLSGRSFSRTEKSEPEPLPAQFNPLAAKAATISLSGFGPGGPFGFD SFLEKWKKDSKKPKPSKKESSSKGGQSEHEAMCNEWLQNGNCPIAKSYRAVSGVLPLVAEVLQPPPGIKYRCPPAIVAARSALAKTAFAKNLRPQPLPAKV | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 13,179.041 | ||
| Theoretical pI: | 11.677 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 56.103 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.243 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332018.1 | complete | 123 | 217-588(+) |
Amino Acid sequence : | |||
| MGRAPSLRMVPISIWRSGSSMGKMALSRFREGHFLGLRSLSRSHYRLSSIPWQLKRQPSASLVSVQAGPSVLILSSKSGRKTARNRNPRKRNLLQRVGNRSMKQCATSGCKTETAPSQSR IEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,179.041 | ||
| Theoretical pI: | 11.677 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 56.103 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.243 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332018.1 | 5prime_partial | 115 | 738-391(-) |
Amino Acid sequence : | |||
| VLSRVEAVGVGFWRKRFSLERSGRPRLLGDTDILCREGAEGPLRREEGRRSRLDTTLRWGSFRFAATRCTLLHAPIAHPLKKIPFSRVSVSCCLSSTFRGKNQNRRARLDRNQRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,179.041 | ||
| Theoretical pI: | 11.677 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 56.103 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.243 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332018.1 | 3prime_partial | 221 | 75-737(+) |
Amino Acid sequence : | |||
| MDFLFGNLNGGSENFDHDIGRCPFLRNINEPTNLSFATSMAFPIPVRDGKGPIFEDGPNFDMAFRLFHGQNGVVPLSGRSFSRTEKSEPEPLPAQFNPLAAKAATISLSGFGPGGPFGFD SFLEKWKKDSKKPKPSKKESSSKGGQSEHEAMCNEWLQNGNCPIAKSYRAVSGVLPLVAEVLQPPPGIKYRCPPAIVAARSALAKTAFAKNLRPQPLPAKV | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 13,179.041 | ||
| Theoretical pI: | 11.677 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 56.103 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.243 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332018.1 | complete | 123 | 217-588(+) |
Amino Acid sequence : | |||
| MGRAPSLRMVPISIWRSGSSMGKMALSRFREGHFLGLRSLSRSHYRLSSIPWQLKRQPSASLVSVQAGPSVLILSSKSGRKTARNRNPRKRNLLQRVGNRSMKQCATSGCKTETAPSQSR IEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,179.041 | ||
| Theoretical pI: | 11.677 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 56.103 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.243 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332018.1 | 5prime_partial | 115 | 738-391(-) |
Amino Acid sequence : | |||
| VLSRVEAVGVGFWRKRFSLERSGRPRLLGDTDILCREGAEGPLRREEGRRSRLDTTLRWGSFRFAATRCTLLHAPIAHPLKKIPFSRVSVSCCLSSTFRGKNQNRRARLDRNQRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,179.041 | ||
| Theoretical pI: | 11.677 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 56.103 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.243 | ||
| sheet | 0.226 | ||