Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332018.1 | 3prime_partial | 221 | 75-737(+) |
Amino Acid sequence : | |||
MDFLFGNLNGGSENFDHDIGRCPFLRNINEPTNLSFATSMAFPIPVRDGKGPIFEDGPNFDMAFRLFHGQNGVVPLSGRSFSRTEKSEPEPLPAQFNPLAAKAATISLSGFGPGGPFGFD SFLEKWKKDSKKPKPSKKESSSKGGQSEHEAMCNEWLQNGNCPIAKSYRAVSGVLPLVAEVLQPPPGIKYRCPPAIVAARSALAKTAFAKNLRPQPLPAKV | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 13,179.041 | ||
Theoretical pI: | 11.677 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 56.103 | ||
aromaticity | 0.070 | ||
GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.243 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332018.1 | complete | 123 | 217-588(+) |
Amino Acid sequence : | |||
MGRAPSLRMVPISIWRSGSSMGKMALSRFREGHFLGLRSLSRSHYRLSSIPWQLKRQPSASLVSVQAGPSVLILSSKSGRKTARNRNPRKRNLLQRVGNRSMKQCATSGCKTETAPSQSR IEP* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,179.041 | ||
Theoretical pI: | 11.677 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 56.103 | ||
aromaticity | 0.070 | ||
GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.243 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332018.1 | 5prime_partial | 115 | 738-391(-) |
Amino Acid sequence : | |||
VLSRVEAVGVGFWRKRFSLERSGRPRLLGDTDILCREGAEGPLRREEGRRSRLDTTLRWGSFRFAATRCTLLHAPIAHPLKKIPFSRVSVSCCLSSTFRGKNQNRRARLDRNQRG* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,179.041 | ||
Theoretical pI: | 11.677 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 56.103 | ||
aromaticity | 0.070 | ||
GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.243 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332018.1 | 3prime_partial | 221 | 75-737(+) |
Amino Acid sequence : | |||
MDFLFGNLNGGSENFDHDIGRCPFLRNINEPTNLSFATSMAFPIPVRDGKGPIFEDGPNFDMAFRLFHGQNGVVPLSGRSFSRTEKSEPEPLPAQFNPLAAKAATISLSGFGPGGPFGFD SFLEKWKKDSKKPKPSKKESSSKGGQSEHEAMCNEWLQNGNCPIAKSYRAVSGVLPLVAEVLQPPPGIKYRCPPAIVAARSALAKTAFAKNLRPQPLPAKV | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 13,179.041 | ||
Theoretical pI: | 11.677 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 56.103 | ||
aromaticity | 0.070 | ||
GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.243 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332018.1 | complete | 123 | 217-588(+) |
Amino Acid sequence : | |||
MGRAPSLRMVPISIWRSGSSMGKMALSRFREGHFLGLRSLSRSHYRLSSIPWQLKRQPSASLVSVQAGPSVLILSSKSGRKTARNRNPRKRNLLQRVGNRSMKQCATSGCKTETAPSQSR IEP* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,179.041 | ||
Theoretical pI: | 11.677 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 56.103 | ||
aromaticity | 0.070 | ||
GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.243 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332018.1 | 5prime_partial | 115 | 738-391(-) |
Amino Acid sequence : | |||
VLSRVEAVGVGFWRKRFSLERSGRPRLLGDTDILCREGAEGPLRREEGRRSRLDTTLRWGSFRFAATRCTLLHAPIAHPLKKIPFSRVSVSCCLSSTFRGKNQNRRARLDRNQRG* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,179.041 | ||
Theoretical pI: | 11.677 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 56.103 | ||
aromaticity | 0.070 | ||
GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.243 | ||
sheet | 0.226 |