| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332020.1 | 5prime_partial | 239 | 1-720(+) |
Amino Acid sequence : | |||
| NSVAMMADDKVVASAGKAEPLRVMISGAPASGKGTQCELITKKYDLVHIAAGDLLRAEVAAGTENGKHAKEFMEKGQLVPDEIVVMMVKERLSQQDSLENGWLLDGYPRSESQATALKKL GFDPDIFILLEVPEDILVERVVGRRLDPVTGKIYHLKYSPPETEEIAARLTQRFDDTEEKVKLRLVTHNSNVEAVLSLYEDLICKVDGTLPKEEVFTQIDTTLSELLTKKEAALRSLAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 26,347.946 | ||
| Theoretical pI: | 5.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 38.835 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.176 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332020.1 | 5prime_partial | 239 | 1-720(+) |
Amino Acid sequence : | |||
| NSVAMMADDKVVASAGKAEPLRVMISGAPASGKGTQCELITKKYDLVHIAAGDLLRAEVAAGTENGKHAKEFMEKGQLVPDEIVVMMVKERLSQQDSLENGWLLDGYPRSESQATALKKL GFDPDIFILLEVPEDILVERVVGRRLDPVTGKIYHLKYSPPETEEIAARLTQRFDDTEEKVKLRLVTHNSNVEAVLSLYEDLICKVDGTLPKEEVFTQIDTTLSELLTKKEAALRSLAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 26,347.946 | ||
| Theoretical pI: | 5.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 38.835 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.176 | ||
| sheet | 0.339 | ||