| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332022.1 | 5prime_partial | 188 | 3-569(+) |
Amino Acid sequence : | |||
| HMKAEFQNLGHANEPQSFTAAESTLYGNIMSDFASHAFGVLAEDGFSPATVYSSVNASYTVDYRAPVGNKTVEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFASDIVRYFKELQP DAQSWLVKSNPVLAGNAPWVALDVTDGLDIRHLNPEEKKVIARAKNHLLRSMQLKGRESLSAEALLES* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 11,377.167 | ||
| Theoretical pI: | 8.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26845 | ||
| Instability index: | 34.912 | ||
| aromaticity | 0.121 | ||
| GRAVY | 0.157 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.273 | ||
| sheet | 0.152 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332022.1 | complete | 99 | 458-159(-) |
Amino Acid sequence : | |||
| MPYIKAISDIQSNPWCIPSQNWIGLDQPTLCIWLEFFEISNNVTGKGFSTLPPCHILENRICRTLVQVLKHSCNFSWAKFHRLVSYGCSVINSIACIYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,377.167 | ||
| Theoretical pI: | 8.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26845 | ||
| Instability index: | 34.912 | ||
| aromaticity | 0.121 | ||
| GRAVY | 0.157 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.273 | ||
| sheet | 0.152 | ||