Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332024.1 | complete | 142 | 97-525(+) |
Amino Acid sequence : | |||
MGKDSKASGKGKGKQAAGGSDDASSKAKGKGGKADGLGTCTYVKARHILCEKQGKINEAYKKLQDGWLNNGDKVPPAEFAKIATEYSECPSGKKGGDLGWFPRGKMAGPFQEVAFNTPVG VTSAPFKSTHGYHIILSEGRKN* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 14,919.712 | ||
Theoretical pI: | 9.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 44.382 | ||
aromaticity | 0.077 | ||
GRAVY | -0.763 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.317 | ||
sheet | 0.204 |