Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332033.1 | internal | 231 | 1-693(+) |
Amino Acid sequence : | |||
THREREREREREMDVSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFETEIEHKLQKIYDDNVCGDDCDLFTTALRF RLLRQHRHHVSCDVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALERPLHREVPILYARHFISIYEKDESMDEHLLX | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 27,255.738 | ||
Theoretical pI: | 5.699 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
Instability index: | 52.670 | ||
aromaticity | 0.087 | ||
GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.126 | ||
sheet | 0.317 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332033.1 | internal | 231 | 1-693(+) |
Amino Acid sequence : | |||
THREREREREREMDVSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFETEIEHKLQKIYDDNVCGDDCDLFTTALRF RLLRQHRHHVSCDVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALERPLHREVPILYARHFISIYEKDESMDEHLLX | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 27,255.738 | ||
Theoretical pI: | 5.699 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
Instability index: | 52.670 | ||
aromaticity | 0.087 | ||
GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.126 | ||
sheet | 0.317 |