Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332041.1 | 5prime_partial | 222 | 1-669(+) |
Amino Acid sequence : | |||
VLFSRERKTGTRMGTSGQGQSTYDLSFKILLIGDSAVGKSSLLVTFISNVVDDLSPTVGVDFKIKFLTVGGKKLKLTIWDTAGQERFRTLTSSYYRGAHGIILVYDVTRRETFTNLSDVW AKELELYSTNEDCVKMLVGNKVDRESERVVSREEGMSLAKELGCLFLECSAKTRENVEQSFEELVLKIMEVPRLLEEGSTVKRNILKQKQEHQTPASGGCCS* | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 24,820.132 | ||
Theoretical pI: | 7.739 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 35.604 | ||
aromaticity | 0.072 | ||
GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.216 | ||
sheet | 0.252 |