| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332053.1 | internal | 284 | 3-854(+) |
Amino Acid sequence : | |||
| NLQKTMFTTLLAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHT QGVEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSER SRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFHNYY | |||
Physicochemical properties | |||
| Number of amino acids: | 284 | ||
| Molecular weight: | 17,666.282 | ||
| Theoretical pI: | 6.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 47.218 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.178 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332053.1 | 5prime_partial | 157 | 854-381(-) |
Amino Acid sequence : | |||
| IIIVKKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGE KWEGHYAPHLAPVLPVHREHHVLPVAREYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,666.282 | ||
| Theoretical pI: | 6.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 47.218 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.178 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332053.1 | internal | 284 | 3-854(+) |
Amino Acid sequence : | |||
| NLQKTMFTTLLAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHT QGVEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSER SRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFHNYY | |||
Physicochemical properties | |||
| Number of amino acids: | 284 | ||
| Molecular weight: | 17,666.282 | ||
| Theoretical pI: | 6.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 47.218 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.178 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332053.1 | 5prime_partial | 157 | 854-381(-) |
Amino Acid sequence : | |||
| IIIVKKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGE KWEGHYAPHLAPVLPVHREHHVLPVAREYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,666.282 | ||
| Theoretical pI: | 6.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 47.218 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.178 | ||
| sheet | 0.280 | ||