Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332059.1 | 5prime_partial | 197 | 1-594(+) |
Amino Acid sequence : | |||
DDLPFKLEEMPTNYGSFKEKVKGLEVRKTIEALERMKELPKRGDVEPGEIPTLMDLGLNPNAATGQNGKTGANSSLLGGETEALQRLKTFAAECKAKPNNKSNNGANDSIYGANFSCKIS PWLAMGCLSPRSMFEELKKSASSVMSGKKNDGTSDTGMNWLMYELLWRDFFRFITKKYSSSKQPSYSPATACTGAAA* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 17,408.904 | ||
Theoretical pI: | 6.394 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 49.015 | ||
aromaticity | 0.119 | ||
GRAVY | 0.276 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.350 | ||
sheet | 0.269 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332059.1 | complete | 160 | 521-39(-) |
Amino Acid sequence : | |||
MNLKKSLHSSSYINQFIPVSDVPSFFLPDITLEADFLSSSNMERGERHPMASHGDILQEKFAPYMLSLAPLLDLLFGFALHSAANVFSLCKASVSPPKREELAPVFPFWPVAAFGLSPKS INVGISPGSTSPLFGNSFILSNASIVFLTSNPFTFSLKLP* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,408.904 | ||
Theoretical pI: | 6.394 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 49.015 | ||
aromaticity | 0.119 | ||
GRAVY | 0.276 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.350 | ||
sheet | 0.269 |