Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332065.1	5prime_partial	125	2-379(+)
Amino Acid sequence :
VIEKAGVAHKIDFREGPALPVLDEMIKDSKNHGAFDFIFVDADKDNYLNYHKRLIELVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITL CRRIT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,100.100
Theoretical pI:		6.324
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14565
Instability index:		41.143
aromaticity		0.096
GRAVY		-0.124
Secondary Structure Fraction
Helix		0.368
turn		0.192
sheet		0.232