Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332069.1 | 5prime_partial | 239 | 2-721(+) |
Amino Acid sequence : | |||
HTLSVFRPHLPMASMAFSSVFAAPLQSLSLAKLQINSNSVLAFLDSSNRPSLGSSKSTFFRDGFPVLSPILPGFSLRSRSFASINARAATGKTIHDFTVKDIEGKDVALNKFKGSILLIV NVASRCGLTSSNYTELSQLYEKYKNQGLEILAFPCNQFGGQEPGSNADIKKFACTRYKAEFPIFDKVDVNGPNTAPVYQFLKSDAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTSPL* | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 12,964.995 | ||
Theoretical pI: | 9.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 38.166 | ||
aromaticity | 0.043 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.216 | ||
sheet | 0.345 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332069.1 | 3prime_partial | 116 | 348-1(-) |
Amino Acid sequence : | |||
MLPLNLLRATSFPSISFTVKSWMVFPVAALALIEAKDRDLNEKPGRIGDKTGKPSRKKVDFEEPRLGRLEESRNAKTELELICSLARDKLCRGAAKTEENAMEAMGRCGRNTLRVC | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,964.995 | ||
Theoretical pI: | 9.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 38.166 | ||
aromaticity | 0.043 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.216 | ||
sheet | 0.345 |