| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332069.1 | 5prime_partial | 239 | 2-721(+) |
Amino Acid sequence : | |||
| HTLSVFRPHLPMASMAFSSVFAAPLQSLSLAKLQINSNSVLAFLDSSNRPSLGSSKSTFFRDGFPVLSPILPGFSLRSRSFASINARAATGKTIHDFTVKDIEGKDVALNKFKGSILLIV NVASRCGLTSSNYTELSQLYEKYKNQGLEILAFPCNQFGGQEPGSNADIKKFACTRYKAEFPIFDKVDVNGPNTAPVYQFLKSDAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTSPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 12,964.995 | ||
| Theoretical pI: | 9.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 38.166 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.216 | ||
| sheet | 0.345 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332069.1 | 3prime_partial | 116 | 348-1(-) |
Amino Acid sequence : | |||
| MLPLNLLRATSFPSISFTVKSWMVFPVAALALIEAKDRDLNEKPGRIGDKTGKPSRKKVDFEEPRLGRLEESRNAKTELELICSLARDKLCRGAAKTEENAMEAMGRCGRNTLRVC | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,964.995 | ||
| Theoretical pI: | 9.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 38.166 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.216 | ||
| sheet | 0.345 | ||