Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332087.1 | 3prime_partial | 239 | 65-781(+) |
Amino Acid sequence : | |||
MLRVAGKRLSSLSWRPPQSSPAAFFSRNSIVGGDSPSDGRTGTASSPVHSIPLLDQIRGFSSGTLAPGQDAGLVSGIPATVAAIKNPSPKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLARLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDIKLANSVDIASLRDPQEDAVRVKNPEWLVVVGVCTHLGCIPLPNAGDYGGWFCPCHGS | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 11,418.714 | ||
Theoretical pI: | 5.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 29.807 | ||
aromaticity | 0.097 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.252 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332087.1 | complete | 120 | 726-364(-) |
Amino Acid sequence : | |||
MQPRWVQTPTTTSHSGFLTLTASSCGSRREAMSTLFASLMSSSVRRLMKTGFPRHFTVTVVPGSILERSTSRDARARTSLLADMLNTNLSTRSRANDAYTNLPPVRTKYANARLLGSPGG * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 11,418.714 | ||
Theoretical pI: | 5.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 29.807 | ||
aromaticity | 0.097 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.252 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332087.1 | 5prime_partial | 103 | 781-470(-) |
Amino Acid sequence : | |||
GSMAWAKPTPVVTGIWQRDATQMGANPHHHEPLWILNPHSIFLWIAKGGDVDTVCQLDVLFSSAPDEDWLPTPLHSHGCPWFDTGEIHLQGCKSEDVFAGRHA* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,418.714 | ||
Theoretical pI: | 5.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 29.807 | ||
aromaticity | 0.097 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.252 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332087.1 | 3prime_partial | 239 | 65-781(+) |
Amino Acid sequence : | |||
MLRVAGKRLSSLSWRPPQSSPAAFFSRNSIVGGDSPSDGRTGTASSPVHSIPLLDQIRGFSSGTLAPGQDAGLVSGIPATVAAIKNPSPKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLARLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDIKLANSVDIASLRDPQEDAVRVKNPEWLVVVGVCTHLGCIPLPNAGDYGGWFCPCHGS | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 11,418.714 | ||
Theoretical pI: | 5.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 29.807 | ||
aromaticity | 0.097 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.252 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332087.1 | complete | 120 | 726-364(-) |
Amino Acid sequence : | |||
MQPRWVQTPTTTSHSGFLTLTASSCGSRREAMSTLFASLMSSSVRRLMKTGFPRHFTVTVVPGSILERSTSRDARARTSLLADMLNTNLSTRSRANDAYTNLPPVRTKYANARLLGSPGG * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 11,418.714 | ||
Theoretical pI: | 5.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 29.807 | ||
aromaticity | 0.097 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.252 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332087.1 | 5prime_partial | 103 | 781-470(-) |
Amino Acid sequence : | |||
GSMAWAKPTPVVTGIWQRDATQMGANPHHHEPLWILNPHSIFLWIAKGGDVDTVCQLDVLFSSAPDEDWLPTPLHSHGCPWFDTGEIHLQGCKSEDVFAGRHA* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,418.714 | ||
Theoretical pI: | 5.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 29.807 | ||
aromaticity | 0.097 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.252 | ||
sheet | 0.214 |