| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332089.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| LLSAEKGESDRWSSYEHVGRAGAFIPTASLAGSEVSVDEIRSAAASSDIYPPSLHAPLLSSPQSHHPSEQVHGYPQDAYYGHLRENSINGQRQPLDEVEIRELLIDHVGHRCCWGSRPAR TWTIHAVEDCNVYVGTLETFTEDRETIIEKVPYLGGDVDGKDKGPELGIWELDLRSEFPPLFVPGKESRIVIPHSEALEKCSGCGGRGDVVCQNCNADQEPGFYKENRMLQCSTCHGRGL LAHMDG | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 12,324.718 | ||
| Theoretical pI: | 6.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 67.810 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.660 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.248 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332089.1 | 5prime_partial | 105 | 737-420(-) |
Amino Acid sequence : | |||
| HPYVPTNLSRDRWSTEASGSPCRNRVLDLHYNFGIRHLLFPHNPNISRELLNEESQCATPFLEQKVEETRTSDPAPISQVQDPCLFHRRLHQDTAPFQLLFLYLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,324.718 | ||
| Theoretical pI: | 6.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 67.810 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.660 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.248 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332089.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| LLSAEKGESDRWSSYEHVGRAGAFIPTASLAGSEVSVDEIRSAAASSDIYPPSLHAPLLSSPQSHHPSEQVHGYPQDAYYGHLRENSINGQRQPLDEVEIRELLIDHVGHRCCWGSRPAR TWTIHAVEDCNVYVGTLETFTEDRETIIEKVPYLGGDVDGKDKGPELGIWELDLRSEFPPLFVPGKESRIVIPHSEALEKCSGCGGRGDVVCQNCNADQEPGFYKENRMLQCSTCHGRGL LAHMDG | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 12,324.718 | ||
| Theoretical pI: | 6.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 67.810 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.660 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.248 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332089.1 | 5prime_partial | 105 | 737-420(-) |
Amino Acid sequence : | |||
| HPYVPTNLSRDRWSTEASGSPCRNRVLDLHYNFGIRHLLFPHNPNISRELLNEESQCATPFLEQKVEETRTSDPAPISQVQDPCLFHRRLHQDTAPFQLLFLYLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,324.718 | ||
| Theoretical pI: | 6.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 67.810 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.660 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.248 | ||
| sheet | 0.238 | ||