| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332091.1 | 5prime_partial | 221 | 3-668(+) |
Amino Acid sequence : | |||
| NVSLGGGVNFAVAGSTALPDFVFVKHGVPIPHPNVSLTAQLRWFRTDFLPAFCHQSAKCRRFLATSLVLVGEIGGNDYNHPFLAGKSLELVKTFVPQVIKRISSTINELIKLGAVTLMVP GNLPIGCSASYLTKFINSNKKDYDPDTGCLKWLNRFSQYHNKLLQQQLTLIRTQNPNINIIYADYYNAAMRFYRSPRKYGFSEGGLRACCGAGGPYNVNLT* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,450.937 | ||
| Theoretical pI: | 9.593 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26275 | ||
| Instability index: | 46.487 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.285 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332091.1 | 5prime_partial | 221 | 3-668(+) |
Amino Acid sequence : | |||
| NVSLGGGVNFAVAGSTALPDFVFVKHGVPIPHPNVSLTAQLRWFRTDFLPAFCHQSAKCRRFLATSLVLVGEIGGNDYNHPFLAGKSLELVKTFVPQVIKRISSTINELIKLGAVTLMVP GNLPIGCSASYLTKFINSNKKDYDPDTGCLKWLNRFSQYHNKLLQQQLTLIRTQNPNINIIYADYYNAAMRFYRSPRKYGFSEGGLRACCGAGGPYNVNLT* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,450.937 | ||
| Theoretical pI: | 9.593 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26275 | ||
| Instability index: | 46.487 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.285 | ||
| sheet | 0.204 | ||