| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332097.1 | complete | 155 | 80-547(+) |
Amino Acid sequence : | |||
| MKQPPPTELLDAPLHTFGFEFDELSATRVSGHLLITQKCCQPFKVLHGGVSAMLAEAVASVGAHIASGFKRVAGVQLSINHLKSAKEGDLLFAEATPVSVGKSIQVWDVALSKCEPSDSD VKTLVASSRVTIICNLSLPESAKDAPENFRRYAKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 16,586.936 | ||
| Theoretical pI: | 6.952 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 35.008 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.072 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.239 | ||
| sheet | 0.290 | ||