Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332097.1 | complete | 155 | 80-547(+) |
Amino Acid sequence : | |||
MKQPPPTELLDAPLHTFGFEFDELSATRVSGHLLITQKCCQPFKVLHGGVSAMLAEAVASVGAHIASGFKRVAGVQLSINHLKSAKEGDLLFAEATPVSVGKSIQVWDVALSKCEPSDSD VKTLVASSRVTIICNLSLPESAKDAPENFRRYAKL* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 16,586.936 | ||
Theoretical pI: | 6.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 35.008 | ||
aromaticity | 0.058 | ||
GRAVY | 0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.239 | ||
sheet | 0.290 |