| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332098.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
| SNLHNFLIMEFKNLSILAFLSVAIVVSHAALPSEEYWSSALPNTVMPKSVKDLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVAL FFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVQTVSTEAHNSERK | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 25,826.496 | ||
| Theoretical pI: | 5.488 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 41.682 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.581 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.246 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332098.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
| SNLHNFLIMEFKNLSILAFLSVAIVVSHAALPSEEYWSSALPNTVMPKSVKDLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVAL FFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVQTVSTEAHNSERK | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 25,826.496 | ||
| Theoretical pI: | 5.488 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 41.682 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.581 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.246 | ||
| sheet | 0.246 | ||