Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332109.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
DALFAKSGVSPQRIDIVVVNVSLLSPAPSLAARIINRYGMREDVKAYNLSGMGCSASLVAVDLVRQLFRVYRDQMAVVVSTESLGPNWYRGIDKSMMLSNCLFRSGGCSMLLTNNPSLRS RAILELKHLVRTHFGSNDEAYNCCIQVEDDEGYPGFRLTKKLTTAAAKAFVINLKVLVPKILPTWELIKFVAVYLRGGSKDKMKLLEALNLKAGVEHF | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 24,129.000 | ||
Theoretical pI: | 9.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 23.665 | ||
aromaticity | 0.078 | ||
GRAVY | 0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.234 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332109.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
DALFAKSGVSPQRIDIVVVNVSLLSPAPSLAARIINRYGMREDVKAYNLSGMGCSASLVAVDLVRQLFRVYRDQMAVVVSTESLGPNWYRGIDKSMMLSNCLFRSGGCSMLLTNNPSLRS RAILELKHLVRTHFGSNDEAYNCCIQVEDDEGYPGFRLTKKLTTAAAKAFVINLKVLVPKILPTWELIKFVAVYLRGGSKDKMKLLEALNLKAGVEHF | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 24,129.000 | ||
Theoretical pI: | 9.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 23.665 | ||
aromaticity | 0.078 | ||
GRAVY | 0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.234 | ||
sheet | 0.284 |