| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332111.1 | 5prime_partial | 168 | 606-100(-) |
Amino Acid sequence : | |||
| AFTGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLS LDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,562.287 | ||
| Theoretical pI: | 5.113 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25105 | ||
| Instability index: | 24.747 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.196 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332111.1 | 5prime_partial | 168 | 606-100(-) |
Amino Acid sequence : | |||
| AFTGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLS LDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,562.287 | ||
| Theoretical pI: | 5.113 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25105 | ||
| Instability index: | 24.747 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.196 | ||
| sheet | 0.280 | ||