Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332115.1 | internal | 182 | 546-1(-) |
Amino Acid sequence : | |||
DQHTICRQSRLIAGKDQRFVEIGQGGVALIPGIRQRTGRHRQRGGPPHRQGDRTGKPPEHGDHPAEGVLHLPPLLQQDQPRTLPACKLRGHVGELCRQHTHGGFILPDGNPRFLCSQRLS AQRLFNDCRCFFRITFRTRKMTPDSGHLLVKSGRIQTQINDQIAYRFSHTGLLLRSLLILSS | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 17,711.105 | ||
Theoretical pI: | 8.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 35.600 | ||
aromaticity | 0.065 | ||
GRAVY | 0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.219 | ||
sheet | 0.343 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332115.1 | 3prime_partial | 169 | 40-546(+) |
Amino Acid sequence : | |||
MAEPVGDLVVDLSLDAARFDEQMARVRRHFSGTESDAKKTAAVVEQSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSFGGMIPMFRGLAGAITL AMGGATSLAVATGALAYAWYQGNSTLSDFNKTLVLSGNQAGLTADRMLV | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 17,711.105 | ||
Theoretical pI: | 8.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 35.600 | ||
aromaticity | 0.065 | ||
GRAVY | 0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.219 | ||
sheet | 0.343 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332115.1 | internal | 182 | 546-1(-) |
Amino Acid sequence : | |||
DQHTICRQSRLIAGKDQRFVEIGQGGVALIPGIRQRTGRHRQRGGPPHRQGDRTGKPPEHGDHPAEGVLHLPPLLQQDQPRTLPACKLRGHVGELCRQHTHGGFILPDGNPRFLCSQRLS AQRLFNDCRCFFRITFRTRKMTPDSGHLLVKSGRIQTQINDQIAYRFSHTGLLLRSLLILSS | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 17,711.105 | ||
Theoretical pI: | 8.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 35.600 | ||
aromaticity | 0.065 | ||
GRAVY | 0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.219 | ||
sheet | 0.343 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332115.1 | 3prime_partial | 169 | 40-546(+) |
Amino Acid sequence : | |||
MAEPVGDLVVDLSLDAARFDEQMARVRRHFSGTESDAKKTAAVVEQSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSFGGMIPMFRGLAGAITL AMGGATSLAVATGALAYAWYQGNSTLSDFNKTLVLSGNQAGLTADRMLV | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 17,711.105 | ||
Theoretical pI: | 8.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 35.600 | ||
aromaticity | 0.065 | ||
GRAVY | 0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.219 | ||
sheet | 0.343 |