| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332116.1 | internal | 272 | 818-3(-) |
Amino Acid sequence : | |||
| LSLDAARFDEQMARVRRHFSGTESDAKKTAAVVEQSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSFGGMIPMFRGLAGAITLPMVGATSLAVA TGALAYAWYQGNSTLSDFNKTLVLSGNQAGLTADRMLVLSRAGQAAGLTFNQTSESLSALVKAGVSGEAQIASISQSVARFSSASGVEVDKVAEAFGKLTTDPTSGLTAMARQFHNVSAE QIAYVAQLQRSGDEAGALQAANEAATKGFDDQ | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 28,256.520 | ||
| Theoretical pI: | 6.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 34.019 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.232 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332116.1 | internal | 272 | 818-3(-) |
Amino Acid sequence : | |||
| LSLDAARFDEQMARVRRHFSGTESDAKKTAAVVEQSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSFGGMIPMFRGLAGAITLPMVGATSLAVA TGALAYAWYQGNSTLSDFNKTLVLSGNQAGLTADRMLVLSRAGQAAGLTFNQTSESLSALVKAGVSGEAQIASISQSVARFSSASGVEVDKVAEAFGKLTTDPTSGLTAMARQFHNVSAE QIAYVAQLQRSGDEAGALQAANEAATKGFDDQ | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 28,256.520 | ||
| Theoretical pI: | 6.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 34.019 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.232 | ||
| sheet | 0.335 | ||