| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332118.1 | complete | 119 | 150-509(+) |
Amino Acid sequence : | |||
| MDMEGGGALPPRRPPTTGISPTVPGRSPGRAPVVPKPGREPPTPGRSLPTPIRASPTAPPTSGIPPGGPIKLNSRLVALQWVAKIMAITPNMTMQILILSISKTHTHISLFSPSPSCKT* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 11,670.181 | ||
| Theoretical pI: | 9.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 46.902 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.872 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.273 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332118.1 | complete | 101 | 451-146(-) |
Amino Acid sequence : | |||
| MERINICIVIFGVMAIIFATHCKATSRELSFIGPPGGIPDVGGAVGDALIGVGSDLPGVGGSLPGFGTTGALPGDLPGTVGDIPVVGGLLGGSAPPPSISI* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,670.181 | ||
| Theoretical pI: | 9.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 46.902 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.872 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.273 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332118.1 | complete | 99 | 389-688(+) |
Amino Acid sequence : | |||
| MGCKDYGHHTKYDNANIDPLHIQNSYSYIIILSLSLLQNLKAKNKEKNGFFKHVLFSHGYPSKESKNCSHSRKILRRRQRGEGHFRLYPWELDEGRPVL* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,670.181 | ||
| Theoretical pI: | 9.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 46.902 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.872 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.273 | ||
| sheet | 0.192 | ||