| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332124.1 | internal | 205 | 1-615(+) |
Amino Acid sequence : | |||
| LTGFFQSTRRLYAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDGRNIWA NDLAASITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQA | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 21,909.545 | ||
| Theoretical pI: | 4.921 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 25.404 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.180 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.205 | ||
| sheet | 0.332 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332124.1 | internal | 205 | 1-615(+) |
Amino Acid sequence : | |||
| LTGFFQSTRRLYAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDGRNIWA NDLAASITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQA | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 21,909.545 | ||
| Theoretical pI: | 4.921 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 25.404 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.180 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.205 | ||
| sheet | 0.332 | ||