| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332133.1 | internal | 214 | 3-644(+) |
Amino Acid sequence : | |||
| WQRRTMQMMYRDITETLRAKGIVANPKDYLSFFCLGNREVKKPGEYEPAQKPEPADSNYARAQAARRTMIYVHSKMMIVDDEYIIVGSANINQRSMEGSRDSEIAMGAYQPYHLSKGQQP ARGEVHGFRMALWYEHAGMLHNSFSLPENVECMRKMNQIGGNNWDLFSRDELEQDLPGHLLSYPVAVAEDGTITHFPGMEIFPDTKAPILGTKS | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 11,391.366 | ||
| Theoretical pI: | 9.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 35.594 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.192 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332133.1 | 5prime_partial | 99 | 644-345(-) |
Amino Acid sequence : | |||
| RLGAENRGLSIRENFHPRKMCYGAVLCHGHWIAKQVTWQVLFQLVARKQIPVIPPYLVHFSHAFNILWKAEGVVQHACVLVPQRHPEPVDLTPCRLLPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,391.366 | ||
| Theoretical pI: | 9.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 35.594 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.192 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332133.1 | internal | 214 | 3-644(+) |
Amino Acid sequence : | |||
| WQRRTMQMMYRDITETLRAKGIVANPKDYLSFFCLGNREVKKPGEYEPAQKPEPADSNYARAQAARRTMIYVHSKMMIVDDEYIIVGSANINQRSMEGSRDSEIAMGAYQPYHLSKGQQP ARGEVHGFRMALWYEHAGMLHNSFSLPENVECMRKMNQIGGNNWDLFSRDELEQDLPGHLLSYPVAVAEDGTITHFPGMEIFPDTKAPILGTKS | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 11,391.366 | ||
| Theoretical pI: | 9.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 35.594 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.192 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332133.1 | 5prime_partial | 99 | 644-345(-) |
Amino Acid sequence : | |||
| RLGAENRGLSIRENFHPRKMCYGAVLCHGHWIAKQVTWQVLFQLVARKQIPVIPPYLVHFSHAFNILWKAEGVVQHACVLVPQRHPEPVDLTPCRLLPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,391.366 | ||
| Theoretical pI: | 9.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 35.594 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.192 | ||
| sheet | 0.242 | ||