| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332143.1 | internal | 274 | 2-823(+) |
Amino Acid sequence : | |||
| ITPFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAA VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFP AHHVNDSVTKSKFDNLYGCRHSLPDGLMRATDVM | |||
Physicochemical properties | |||
| Number of amino acids: | 274 | ||
| Molecular weight: | 27,403.617 | ||
| Theoretical pI: | 5.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.722 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.285 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332143.1 | 5prime_partial | 263 | 823-32(-) |
Amino Acid sequence : | |||
| HYISSPHKSIRQRVAASVQVIELALGDGIIDMMGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITA VVDDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLG HVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 27,403.617 | ||
| Theoretical pI: | 5.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.722 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.285 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332143.1 | internal | 274 | 2-823(+) |
Amino Acid sequence : | |||
| ITPFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAA VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFP AHHVNDSVTKSKFDNLYGCRHSLPDGLMRATDVM | |||
Physicochemical properties | |||
| Number of amino acids: | 274 | ||
| Molecular weight: | 27,403.617 | ||
| Theoretical pI: | 5.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.722 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.285 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332143.1 | 5prime_partial | 263 | 823-32(-) |
Amino Acid sequence : | |||
| HYISSPHKSIRQRVAASVQVIELALGDGIIDMMGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITA VVDDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLG HVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 27,403.617 | ||
| Theoretical pI: | 5.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.722 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.285 | ||
| sheet | 0.323 | ||