| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332145.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| GFYGYGNESMDGLNELNRGPRTKSTKNLKGFTPVTLAVKGQNIPLAETADNEKLSVIPDREQYNRPDFPETYSDVKFFIIKSYSEDDVHKSIKYNIWASTPNGNKKLDAAYQSAQQQPGG CPVFLFFSVNTSGQFVGVAEMVGPVDFNKNVDYWQQDKWIGCFPVKWHIVKDVPNSLLKHITLENNENKPVTNSRDTQEVKLEQGLEVLKIFKDHISKQCILDDFDFYEDRQKKILEKKA | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 12,976.421 | ||
| Theoretical pI: | 8.261 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 48.392 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.557 | ||
Secondary Structure Fraction | |||
| Helix | 0.500 | ||
| turn | 0.170 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332145.1 | 5prime_partial | 112 | 720-382(-) |
Amino Acid sequence : | |||
| GFLLQDLFLPILVEIKVIKDTLLAYVILKDFEHLEPLLQLYLLGVPTVGYGFVLIILKGNMLQQTVWHILHNMPLNWKTTNPFVLLPVIHILIEVHRTNHLRYTNKLTTGIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,976.421 | ||
| Theoretical pI: | 8.261 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 48.392 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.557 | ||
Secondary Structure Fraction | |||
| Helix | 0.500 | ||
| turn | 0.170 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332145.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| GFYGYGNESMDGLNELNRGPRTKSTKNLKGFTPVTLAVKGQNIPLAETADNEKLSVIPDREQYNRPDFPETYSDVKFFIIKSYSEDDVHKSIKYNIWASTPNGNKKLDAAYQSAQQQPGG CPVFLFFSVNTSGQFVGVAEMVGPVDFNKNVDYWQQDKWIGCFPVKWHIVKDVPNSLLKHITLENNENKPVTNSRDTQEVKLEQGLEVLKIFKDHISKQCILDDFDFYEDRQKKILEKKA | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 12,976.421 | ||
| Theoretical pI: | 8.261 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 48.392 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.557 | ||
Secondary Structure Fraction | |||
| Helix | 0.500 | ||
| turn | 0.170 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332145.1 | 5prime_partial | 112 | 720-382(-) |
Amino Acid sequence : | |||
| GFLLQDLFLPILVEIKVIKDTLLAYVILKDFEHLEPLLQLYLLGVPTVGYGFVLIILKGNMLQQTVWHILHNMPLNWKTTNPFVLLPVIHILIEVHRTNHLRYTNKLTTGIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,976.421 | ||
| Theoretical pI: | 8.261 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 48.392 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.557 | ||
Secondary Structure Fraction | |||
| Helix | 0.500 | ||
| turn | 0.170 | ||
| sheet | 0.277 | ||