Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332149.1	internal	274	1-822(+)
Amino Acid sequence :
IVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSHALVISTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRRDRSRAKYKLVHVVRTHKGADDKAYKCVYEQEDPEGK VGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGRM KKGDRVWQIAFGSGFKCNSAVWKCNRTNQTPTDG
Physicochemical properties
Number of amino acids:		274
Molecular weight:		11,762.112
Theoretical pI:		10.777
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		64.678
aromaticity		0.019
GRAVY		-0.888
Secondary Structure Fraction
Helix		0.202
turn		0.202
sheet		0.288

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332149.1	5prime_partial	113	822-481(-)
Amino Acid sequence :
PVGRRLIRPVAFPDGAVAFESAPKSDLPNSVSLLHSPFGLDVPQFVPQRRRRRVAEAVECHPRRLHMLRRQLEVLLQLVDHRPPAGVDAEVLERLFEVGDVGLPFGVEDFPAY*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		11,762.112
Theoretical pI:		10.777
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		64.678
aromaticity		0.019
GRAVY		-0.888
Secondary Structure Fraction
Helix		0.202
turn		0.202
sheet		0.288

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332149.1	3prime_partial	104	510-821(+)
Amino Acid sequence :
MEALHPRLQTSVRALLHPRRRAGGDRRAAEEPPAVGGACGGVADDTPPLRQHVVVVAVVRIGVHRGQRENEEGRQSLADRFWERIQMQQRRLEMQPDESNADRR
Physicochemical properties
Number of amino acids:		104
Molecular weight:		11,762.112
Theoretical pI:		10.777
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		64.678
aromaticity		0.019
GRAVY		-0.888
Secondary Structure Fraction
Helix		0.202
turn		0.202
sheet		0.288

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332149.1	internal	274	1-822(+)
Amino Acid sequence :
IVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSHALVISTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRRDRSRAKYKLVHVVRTHKGADDKAYKCVYEQEDPEGK VGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGRM KKGDRVWQIAFGSGFKCNSAVWKCNRTNQTPTDG
Physicochemical properties
Number of amino acids:		274
Molecular weight:		11,762.112
Theoretical pI:		10.777
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		64.678
aromaticity		0.019
GRAVY		-0.888
Secondary Structure Fraction
Helix		0.202
turn		0.202
sheet		0.288

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332149.1	5prime_partial	113	822-481(-)
Amino Acid sequence :
PVGRRLIRPVAFPDGAVAFESAPKSDLPNSVSLLHSPFGLDVPQFVPQRRRRRVAEAVECHPRRLHMLRRQLEVLLQLVDHRPPAGVDAEVLERLFEVGDVGLPFGVEDFPAY*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		11,762.112
Theoretical pI:		10.777
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		64.678
aromaticity		0.019
GRAVY		-0.888
Secondary Structure Fraction
Helix		0.202
turn		0.202
sheet		0.288

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332149.1	3prime_partial	104	510-821(+)
Amino Acid sequence :
MEALHPRLQTSVRALLHPRRRAGGDRRAAEEPPAVGGACGGVADDTPPLRQHVVVVAVVRIGVHRGQRENEEGRQSLADRFWERIQMQQRRLEMQPDESNADRR
Physicochemical properties
Number of amino acids:		104
Molecular weight:		11,762.112
Theoretical pI:		10.777
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		64.678
aromaticity		0.019
GRAVY		-0.888
Secondary Structure Fraction
Helix		0.202
turn		0.202
sheet		0.288