| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332154.1 | complete | 118 | 414-770(+) |
Amino Acid sequence : | |||
| MGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLSEVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,833.393 | ||
| Theoretical pI: | 11.258 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 69.335 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.849 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.168 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332154.1 | 5prime_partial | 113 | 768-427(-) |
Amino Acid sequence : | |||
| TSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRRGLDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,833.393 | ||
| Theoretical pI: | 11.258 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 69.335 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.849 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.168 | ||
| sheet | 0.257 | ||