Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332154.1 | complete | 118 | 414-770(+) |
Amino Acid sequence : | |||
MGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLSEVDQR* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,833.393 | ||
Theoretical pI: | 11.258 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 69.335 | ||
aromaticity | 0.044 | ||
GRAVY | -0.849 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.168 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332154.1 | 5prime_partial | 113 | 768-427(-) |
Amino Acid sequence : | |||
TSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRRGLDVT* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,833.393 | ||
Theoretical pI: | 11.258 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 69.335 | ||
aromaticity | 0.044 | ||
GRAVY | -0.849 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.168 | ||
sheet | 0.257 |