| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332157.1 | internal | 185 | 2-556(+) |
Amino Acid sequence : | |||
| VWENVLXEGNDLYREMIESGVIKLGEKQAESKCALVYGQMNEPPGARARVALTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLASDIGCLQERITTTKKG SITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRSISELGILSAGDPLDSTSRMXHPHIVGESH | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 19,693.953 | ||
| Theoretical pI: | 4.841 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 38.168 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.086 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.235 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332157.1 | internal | 185 | 2-556(+) |
Amino Acid sequence : | |||
| VWENVLXEGNDLYREMIESGVIKLGEKQAESKCALVYGQMNEPPGARARVALTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLASDIGCLQERITTTKKG SITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRSISELGILSAGDPLDSTSRMXHPHIVGESH | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 19,693.953 | ||
| Theoretical pI: | 4.841 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 38.168 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.086 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.235 | ||
| sheet | 0.284 | ||