| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332166.1 | 5prime_partial | 207 | 1-624(+) |
Amino Acid sequence : | |||
| GHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKT IFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCDVQLSVCWWCDHG* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,430.285 | ||
| Theoretical pI: | 8.341 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
| Instability index: | 23.018 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.227 | ||
| sheet | 0.193 | ||