Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332166.1 | 5prime_partial | 207 | 1-624(+) |
Amino Acid sequence : | |||
GHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKT IFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCDVQLSVCWWCDHG* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 22,430.285 | ||
Theoretical pI: | 8.341 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
Instability index: | 23.018 | ||
aromaticity | 0.063 | ||
GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.227 | ||
sheet | 0.193 |