| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332168.1 | complete | 201 | 46-651(+) |
Amino Acid sequence : | |||
| MGSLSKDAREEVIQAWYMDDSDEDQRLPHHRNPKEFVSFEKLDELGVLSWRLDADNYETDPELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKSFYEEHLHTDEEIRYCVAGSGYFDVRD QDEGWIRIWVKKGAMIVLPAGIYHRFTLDSNNYIKAMRLFVGDPIWTSFNRPHDHLPARQQYVENFLKKEGAGQAAVDATA* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 23,635.136 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44015 | ||
| Instability index: | 27.267 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.760 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.184 | ||
| sheet | 0.259 | ||