Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332168.1 | complete | 201 | 46-651(+) |
Amino Acid sequence : | |||
MGSLSKDAREEVIQAWYMDDSDEDQRLPHHRNPKEFVSFEKLDELGVLSWRLDADNYETDPELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKSFYEEHLHTDEEIRYCVAGSGYFDVRD QDEGWIRIWVKKGAMIVLPAGIYHRFTLDSNNYIKAMRLFVGDPIWTSFNRPHDHLPARQQYVENFLKKEGAGQAAVDATA* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 23,635.136 | ||
Theoretical pI: | 4.976 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44015 | ||
Instability index: | 27.267 | ||
aromaticity | 0.124 | ||
GRAVY | -0.760 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.184 | ||
sheet | 0.259 |