| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332171.1 | internal | 177 | 3-533(+) |
Amino Acid sequence : | |||
| IPPPSMADADVKLPSLAQHYLLDEKDQKPAIAEKSVEESEAKPSIDNVAEESVHKIEATPNAVDSDVAPAAGEGVEGASGESNDFSPVDDAADSANSAPVEETSDSAESGESADQEADET PEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDEAPECDKFAKYYRSLCPG | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 18,947.209 | ||
| Theoretical pI: | 4.257 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 54.077 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.736 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.249 | ||
| sheet | 0.311 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332171.1 | internal | 177 | 3-533(+) |
Amino Acid sequence : | |||
| IPPPSMADADVKLPSLAQHYLLDEKDQKPAIAEKSVEESEAKPSIDNVAEESVHKIEATPNAVDSDVAPAAGEGVEGASGESNDFSPVDDAADSANSAPVEETSDSAESGESADQEADET PEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDEAPECDKFAKYYRSLCPG | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 18,947.209 | ||
| Theoretical pI: | 4.257 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 54.077 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.736 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.249 | ||
| sheet | 0.311 | ||