| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332174.1 | 3prime_partial | 145 | 191-625(+) |
Amino Acid sequence : | |||
| MVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPSEFTQPSYQ | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,907.899 | ||
| Theoretical pI: | 5.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 38.863 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.221 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332174.1 | 3prime_partial | 145 | 191-625(+) |
Amino Acid sequence : | |||
| MVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPSEFTQPSYQ | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,907.899 | ||
| Theoretical pI: | 5.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 38.863 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.221 | ||
| sheet | 0.221 | ||