Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332184.1 | complete | 135 | 3-410(+) |
Amino Acid sequence : | |||
MASVTAPTVNFSSVSCLVKQNQASNLKKTSLSFSGKAFQSRRLPALRFRVACAAKPETVDKVVDIVRKQLALAEDRVVNGESKFSTLGADSLDTVEIVMGLEEEFGICVEEESAQSISTV QEAADLIETLLEKKC* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,599.536 | ||
Theoretical pI: | 5.079 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 48.022 | ||
aromaticity | 0.044 | ||
GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.200 | ||
sheet | 0.311 |