| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332184.1 | complete | 135 | 3-410(+) |
Amino Acid sequence : | |||
| MASVTAPTVNFSSVSCLVKQNQASNLKKTSLSFSGKAFQSRRLPALRFRVACAAKPETVDKVVDIVRKQLALAEDRVVNGESKFSTLGADSLDTVEIVMGLEEEFGICVEEESAQSISTV QEAADLIETLLEKKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,599.536 | ||
| Theoretical pI: | 5.079 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
| Instability index: | 48.022 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.200 | ||
| sheet | 0.311 | ||