| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332195.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
| KVDYIAGGATQNSIRVAQWMLQIPGATSYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCAVCVLGGERSLIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESM LLVAEHAIANNKVFATNLSAPFICEFFKEAQEKILPYTDFVFGNETEALTFSRVHGWETENIQEIALKISQWPKASGTHKRITVITQGADPVIVAEDGKVKLLPVIPLSKEKLID | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 25,983.487 | ||
| Theoretical pI: | 6.014 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
| Instability index: | 34.893 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.217 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332195.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
| KVDYIAGGATQNSIRVAQWMLQIPGATSYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCAVCVLGGERSLIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESM LLVAEHAIANNKVFATNLSAPFICEFFKEAQEKILPYTDFVFGNETEALTFSRVHGWETENIQEIALKISQWPKASGTHKRITVITQGADPVIVAEDGKVKLLPVIPLSKEKLID | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 25,983.487 | ||
| Theoretical pI: | 6.014 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
| Instability index: | 34.893 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.217 | ||
| sheet | 0.277 | ||