Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332204.1 | complete | 218 | 36-692(+) |
Amino Acid sequence : | |||
MEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALF FLEKDLYAGNKMTLQFYKDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGEQR* | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 24,502.122 | ||
Theoretical pI: | 5.473 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 39.880 | ||
aromaticity | 0.078 | ||
GRAVY | -0.635 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.211 | ||
sheet | 0.229 |