| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332212.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
| LFKPETLFFNFEMASPREENVYMAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNESHVSSIKSYRSKIEAELCSICDGILKLLD SKLIGSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLR XHLTLWTSDM | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 14,896.495 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35980 35980 | ||
| Instability index: | 110.156 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.390 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332212.1 | 5prime_partial | 136 | 2-412(+) |
Amino Acid sequence : | |||
| SSNQKLYSSTLKWRPHARRTCTWPSWRSRPSATRRWSSSWRRSSAPSTATSSLWRSAISSPSPIRTSSVLAALPGGSSLRSSRRKKAAVTRATSPPSKATDLRSRRSYALSATAFSSSLT RNSSDPPPTAIPRFST* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,896.495 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35980 35980 | ||
| Instability index: | 110.156 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.390 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332212.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
| LFKPETLFFNFEMASPREENVYMAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNESHVSSIKSYRSKIEAELCSICDGILKLLD SKLIGSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLR XHLTLWTSDM | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 14,896.495 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35980 35980 | ||
| Instability index: | 110.156 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.390 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332212.1 | 5prime_partial | 136 | 2-412(+) |
Amino Acid sequence : | |||
| SSNQKLYSSTLKWRPHARRTCTWPSWRSRPSATRRWSSSWRRSSAPSTATSSLWRSAISSPSPIRTSSVLAALPGGSSLRSSRRKKAAVTRATSPPSKATDLRSRRSYALSATAFSSSLT RNSSDPPPTAIPRFST* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,896.495 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35980 35980 | ||
| Instability index: | 110.156 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.390 | ||
| sheet | 0.176 | ||