| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332227.1 | complete | 214 | 3-647(+) |
Amino Acid sequence : | |||
| MSLFGLGRNQRTFRPKKSAPSGSKGAQLRQHIDATLGSGNLREAVRLPPGEDFNEWLAVNTVDFFNQVNLLYGTLTEFCTSENCPTMSAGPKYEYRWADGVAIKKPIEVSAPKYVEYLMD WIESQLDDESLFPQKLGAPFPSNFKDVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFNLIDKKELAPLQDLIESIVSY* | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,533.809 | ||
| Theoretical pI: | 7.007 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 42.652 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.224 | ||
| sheet | 0.248 | ||