| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332230.1 | 5prime_partial | 164 | 702-208(-) |
Amino Acid sequence : | |||
| ALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLPKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVGETFSA YPPLGRFAVRDMRQTVAVGVIKSVEKKDPTGAKVTKAAAKKGAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,629.265 | ||
| Theoretical pI: | 9.710 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 24.752 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.244 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332230.1 | 5prime_partial | 164 | 702-208(-) |
Amino Acid sequence : | |||
| ALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLPKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVGETFSA YPPLGRFAVRDMRQTVAVGVIKSVEKKDPTGAKVTKAAAKKGAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,629.265 | ||
| Theoretical pI: | 9.710 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 24.752 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.244 | ||
| sheet | 0.250 | ||