| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332231.1 | 3prime_partial | 242 | 54-779(+) |
Amino Acid sequence : | |||
| MGKEKTHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDGIMEPKRPSDKPPLSPTSG CV | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 12,184.903 | ||
| Theoretical pI: | 6.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 27.029 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.304 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332231.1 | 3prime_partial | 112 | 338-3(-) |
Amino Acid sequence : | |||
| MAGSINNRAVVLGGLEFPQRNINGDTTLTLSLELVKYPCILEGPLVHLSSFLLKPLNDTLVNTTKLVNQMPSGGRLSRVDVANDHNANVSLFLTHVSSIKPSDMNREKICEA | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,184.903 | ||
| Theoretical pI: | 6.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 27.029 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.304 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332231.1 | 3prime_partial | 242 | 54-779(+) |
Amino Acid sequence : | |||
| MGKEKTHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDGIMEPKRPSDKPPLSPTSG CV | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 12,184.903 | ||
| Theoretical pI: | 6.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 27.029 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.304 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332231.1 | 3prime_partial | 112 | 338-3(-) |
Amino Acid sequence : | |||
| MAGSINNRAVVLGGLEFPQRNINGDTTLTLSLELVKYPCILEGPLVHLSSFLLKPLNDTLVNTTKLVNQMPSGGRLSRVDVANDHNANVSLFLTHVSSIKPSDMNREKICEA | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,184.903 | ||
| Theoretical pI: | 6.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 27.029 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.304 | ||
| sheet | 0.268 | ||