| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332241.1 | complete | 245 | 70-807(+) |
Amino Acid sequence : | |||
| MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDTGIKYIPSNTFSYYDQVLDTTAMLGAVPLRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLN RNLFC* | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,337.017 | ||
| Theoretical pI: | 5.323 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
| Instability index: | 27.493 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.233 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332241.1 | complete | 245 | 70-807(+) |
Amino Acid sequence : | |||
| MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDTGIKYIPSNTFSYYDQVLDTTAMLGAVPLRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLN RNLFC* | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,337.017 | ||
| Theoretical pI: | 5.323 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
| Instability index: | 27.493 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.233 | ||
| sheet | 0.294 | ||